PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma186g00240.1
Common NameZOSMA_186G00240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 403aa    MW: 44763.8 Da    PI: 5.8878
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma186g00240.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.54.1e-073393712254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        +yp+++++++L +++gL+ +q+ +WF N+R +
  Zosma186g00240.1 339 WPYPTEDDKARLVQETGLQLKQINNWFINQRKR 371
                       58*****************************87 PP

2ELK29.41.8e-10292313122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+ +++++++E++
  Zosma186g00240.1 292 ELKHELKQGYKDKIVDIREEIL 313
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.7E-19120164IPR005540KNOX1
PfamPF037901.3E-17122163IPR005540KNOX1
SMARTSM012561.0E-19179234IPR005541KNOX2
PfamPF037918.6E-16183233IPR005541KNOX2
PROSITE profilePS512139.969292312IPR005539ELK domain
SMARTSM011885.1E-4292313IPR005539ELK domain
PfamPF037891.3E-5292313IPR005539ELK domain
PROSITE profilePS5007111.256312375IPR001356Homeobox domain
SMARTSM003891.7E-10314379IPR001356Homeobox domain
SuperFamilySSF466891.24E-15314378IPR009057Homeodomain-like
CDDcd000867.04E-11315376No hitNo description
Gene3DG3DSA:1.10.10.607.0E-24319376IPR009057Homeodomain-like
PfamPF059202.9E-17332371IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MEFHNHHLNH DMSLYGGGGG GGGGRDPSSN GEGGRPTWLS SAILRQQTPY DVDGNFLHLQ  60
TRENNASGQW LPRPHPTSQI LRQTASVSAE IQTVEGDVGE REGGRGGGSE EEDGRTWQNA  120
RYKAEIVAHP LFEQLLSAHV ACLRVATPVD QIPKIDAQLS QSQSVFARYS VLGGGTTGMP  180
TMLGDDKELE QLLTHYVLLL CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ TLTGISPGEG  240
TGATMSDDED EPFDTEGGNF YEGNVDGTDS MGFGPLIPTE SERSLMERVR QELKHELKQG  300
YKDKIVDIRE EILRKRRAGK LPGDTTLLLK AWWQSHSKWP YPTEDDKARL VQETGLQLKQ  360
INNWFINQRK RNWHTNPSSS NLLKSKRKSN AAAGDSSSER FM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265706.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480001e-172KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0K9PQF30.0A0A0K9PQF3_Z
STRINGGSMUA_Achr7P05170_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-155KNOTTED1-like homeobox gene 3